GBA Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2096201
Artikelname: GBA Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2096201
Hersteller Artikelnummer: orb2096201
Alternativnummer: BYT-ORB2096201-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human GLCM
Konjugation: HRP
Alternative Synonym: GCB, GBA1, GLUC
GBA Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 58kDa
NCBI: 006711333
UniProt: P04062
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: FSSPSREECPKPLSRVSIMAGSLTGLLLLQAVSWASGARPCIPKSFGYSS