GBA Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2096202
Artikelname: GBA Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2096202
Hersteller Artikelnummer: orb2096202
Alternativnummer: BYT-ORB2096202-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human GLCM
Konjugation: FITC
Alternative Synonym: GCB, GBA1, GLUC
GBA Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 58kDa
NCBI: 006711333
UniProt: P04062
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: FSSPSREECPKPLSRVSIMAGSLTGLLLLQAVSWASGARPCIPKSFGYSS