RACK1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2096217
Artikelname: RACK1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2096217
Hersteller Artikelnummer: orb2096217
Alternativnummer: BYT-ORB2096217-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Gnb2l1
Konjugation: FITC
Alternative Synonym: p20, Gnb2, p205, GB-li, Gnb2-, Gnb2l1, GB-like, AL033335, Gnb2-rs1
RACK1 Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 032169
UniProt: P68040
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: HIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIIN