PDGFRA Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2096551
Artikelname: PDGFRA Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2096551
Hersteller Artikelnummer: orb2096551
Alternativnummer: BYT-ORB2096551-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen for Anti-PDGFRA antibody is: synthetic peptide directed towards the C-terminal region of Human PGFRA
Konjugation: Biotin
Alternative Synonym: CD140A, PDGFR2, PDGFR-2
PDGFRA Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 119 kDa
UniProt: P16234
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SGYIIPLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDE