FLT1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2096596
Artikelname: FLT1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2096596
Hersteller Artikelnummer: orb2096596
Alternativnummer: BYT-ORB2096596-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FLT1
Konjugation: Biotin
Alternative Synonym: FLT, FLT-1, VEGFR1, VEGFR-1
FLT1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 50kDa
UniProt: P17948
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: DLRVTSKSKESGLSDVSRPSFCHSSCGHVSEGKRRFTYDHAELERKIACC