CD34 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2096620
Artikelname: CD34 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2096620
Hersteller Artikelnummer: orb2096620
Alternativnummer: BYT-ORB2096620-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CD34
Konjugation: Biotin
CD34 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 001764
UniProt: Q3C1E7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: DLKKLGILDFTEQDVASHQSYSQKTLIALVTSGALLAVLGITGYFLMNRR