UNK Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2096734
Artikelname: UNK Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2096734
Hersteller Artikelnummer: orb2096734
Alternativnummer: BYT-ORB2096734-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human UNK
Konjugation: Biotin
Alternative Synonym: ZC3H5, UNKEMPT, ZC3HDC5
UNK Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 89 kDa
NCBI: 001073888
UniProt: Q9C0B0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: DAWKKEAEEAGERASAAGAECELAREQRDALEVQVKKLQEELERLHAGPE