ABHD11 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2096782
| Artikelname: |
ABHD11 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2096782 |
| Hersteller Artikelnummer: |
orb2096782 |
| Alternativnummer: |
BYT-ORB2096782-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen for Anti-ABHD11 antibody is: synthetic peptide directed towards the N-terminal region of Human ABHDB |
| Konjugation: |
Biotin |
| Alternative Synonym: |
PP1226, WBSCR21 |
| ABHD11 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
34 kDa |
| UniProt: |
Q8NFV4 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: FNSIAKILAQQTGRRVLTVDARNHGDSPHSPDMSYEIMSQDLQDLLPQLG |
