Sf3b5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2096788
Artikelname: Sf3b5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2096788
Hersteller Artikelnummer: orb2096788
Alternativnummer: BYT-ORB2096788-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Sf3b5
Konjugation: Biotin
Alternative Synonym: 10kD, 10kDa, Sf3b1, Sf3b10, AU043053, 1110005L13Rik
Sf3b5 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 10kDa
NCBI: 780311
UniProt: Q923D4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: RDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPSGPPADKPEEN