IL27 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2096959
| Artikelname: |
IL27 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2096959 |
| Hersteller Artikelnummer: |
orb2096959 |
| Alternativnummer: |
BYT-ORB2096959-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human IL27 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
p28, IL30, IL-27, IL27A, IL-27A, IL27p28 |
| IL27 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
27kDa |
| NCBI: |
663634 |
| UniProt: |
Q8NEV9 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: AQVSWPQLLSTYRLLHSLELVLSRAVRELLLLSKAGHSVWPLGFPTLSPQ |
