Il20rb Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2096965
Artikelname: Il20rb Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2096965
Hersteller Artikelnummer: orb2096965
Alternativnummer: BYT-ORB2096965-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Mouse Il20rb
Konjugation: Biotin
Alternative Synonym: Il2, Fndc, Fndc6, Gm186, Il20R2, AV228068
Il20rb Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 31kDa
NCBI: 001028715
UniProt: E9Q9A6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LEDLGPQFEFLVVYWRREPGAAEHVKMVRSGDIPVHLETMEPGAMYCVKA