WDR73 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2097022
Artikelname: WDR73 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2097022
Hersteller Artikelnummer: orb2097022
Alternativnummer: BYT-ORB2097022-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WDR73
Konjugation: Biotin
Alternative Synonym: GAMOS, GAMOS1, HSPC264
WDR73 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 42kDa
NCBI: 116245
UniProt: Q6P4I2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VVDLESRKTTYTSDVSDSEELSSLQVLDADTFAFCCASGRLGLVDTRQKW