UTP4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2097046
Artikelname: UTP4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2097046
Hersteller Artikelnummer: orb2097046
Alternativnummer: BYT-ORB2097046-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen for Anti-CIRH1A antibody is: synthetic peptide directed towards the Middle region of Human CIR1A
Konjugation: Biotin
Alternative Synonym: NAIC, CIRH1A, CIRHIN, TEX292
UTP4 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 68 kDa
UniProt: Q969X6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: FAHHLELWRLGSTVATGKNGDTLPLSKNADHLLHLKTKGPENIICSCISP