ROPN1L Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2097193
Artikelname: ROPN1L Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2097193
Hersteller Artikelnummer: orb2097193
Alternativnummer: BYT-ORB2097193-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ROPN1L
Konjugation: Biotin
Alternative Synonym: ASP, RSPH11
ROPN1L Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 26kDa
NCBI: 114122
UniProt: Q96C74
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: DVSPLETESYLASLKENIDARKNGMIGLSDFFFPKRKLLESIENSEDVGH