FCAMR Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2097199
Artikelname: FCAMR Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2097199
Hersteller Artikelnummer: orb2097199
Alternativnummer: BYT-ORB2097199-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FCAMR
Konjugation: Biotin
Alternative Synonym: CD351, FCA/MR, FKSG87
FCAMR Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 62kDa
NCBI: 001164102
UniProt: Q8WWV6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: ATLSQTPAVGPWGPPGKESSVKRTFPEDESSSRTLAPVSTMLALFMLMAL