SLC25A33 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2097277
| Artikelname: |
SLC25A33 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2097277 |
| Hersteller Artikelnummer: |
orb2097277 |
| Alternativnummer: |
BYT-ORB2097277-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the following sequence SCIAYPHEVIRTRLREEGTKYKSFVQTARLVFREEGYLAFYRGLFAQLIR |
| Konjugation: |
Biotin |
| Alternative Synonym: |
PNC1, BMSC-MCP |
| SLC25A33 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
35 kDa |
| NCBI: |
115691 |
| UniProt: |
Q9BSK2 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: SCIAYPHEVIRTRLREEGTKYKSFVQTARLVFREEGYLAFYRGLFAQLIR |
