PCBD2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2097304
Artikelname: PCBD2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2097304
Hersteller Artikelnummer: orb2097304
Alternativnummer: BYT-ORB2097304-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PCBD2
Konjugation: Biotin
Alternative Synonym: PHS2, DCOH2, DCOHM
PCBD2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 14kDa
NCBI: 115527
UniProt: Q9H0N5
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SGTHRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNFNQAFGFMSR