NAA38 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2097337
Artikelname: NAA38 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2097337
Hersteller Artikelnummer: orb2097337
Alternativnummer: BYT-ORB2097337-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen for Anti-NAA38 antibody is: synthetic peptide directed towards the C-terminal region of Human LSMD1
Konjugation: Biotin
Alternative Synonym: LSMD1, MAK31, PFAAP2
NAA38 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 19 kDa
UniProt: Q9BRA0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MRIRMTDGRTLVGCFLCTDRDCNVILGSAQEFLKPSDSFSAGEPRVLGLA