Fyttd1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2097355
Artikelname: Fyttd1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2097355
Hersteller Artikelnummer: orb2097355
Alternativnummer: BYT-ORB2097355-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Fyttd1
Konjugation: Biotin
Alternative Synonym: Ac1176, RGD1306899
Fyttd1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 20kDa
NCBI: 001041364
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: TEQLIDDVVAKRTRQTQKPRLTRTAVPSFLTKREQSDVKKIPKGVPLQFD