FBXW9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2097364
Artikelname: FBXW9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2097364
Hersteller Artikelnummer: orb2097364
Alternativnummer: BYT-ORB2097364-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FBXW9
Konjugation: Biotin
Alternative Synonym: Fbw9, MEC-15
FBXW9 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 51kDa
NCBI: 115677
UniProt: Q5XUX1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: PDILVTGTYDKKVTIYDPRAGPALLKHQQLHSRPVLTLLADDRHIISGSE