ELMOD3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2097379
Artikelname: ELMOD3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2097379
Hersteller Artikelnummer: orb2097379
Alternativnummer: BYT-ORB2097379-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ELMOD3
Konjugation: Biotin
Alternative Synonym: LST3, RBED1, RBM29, DFNB88
ELMOD3 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 44kDa
NCBI: 115589
UniProt: Q96FG2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: FRLSRHHIQQFPFCLMSVNITHIAIQALREECLSRECNRQQKVIPVVNSF