BRMS1L Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2097406
Artikelname: BRMS1L Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2097406
Hersteller Artikelnummer: orb2097406
Alternativnummer: BYT-ORB2097406-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human BRMS1L
Konjugation: Biotin
Alternative Synonym: BRMS1
BRMS1L Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 37kDa
NCBI: 115728
UniProt: Q5PSV4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: GQTICIDKKDECPTSAVITTINHDEVWFKRPDGSKSKLYISQLQKGKYSI