SPIRE2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2097445
Artikelname: SPIRE2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2097445
Hersteller Artikelnummer: orb2097445
Alternativnummer: BYT-ORB2097445-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SPIRE2
Konjugation: Biotin
Alternative Synonym: Spir-2
SPIRE2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 80kDa
NCBI: 115827
UniProt: Q8WWL2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: EAQTVQSLGFAIYRALDWGLDESEERELSPQLERLIDLMANNDSEDSGCG