OR2K2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2098315
Artikelname: OR2K2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2098315
Hersteller Artikelnummer: orb2098315
Alternativnummer: BYT-ORB2098315-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human OR2K2
Konjugation: Biotin
Alternative Synonym: OR2AN1P, OR2AR1P, HTPCRH06, HSHTPCRH06
OR2K2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 995581
UniProt: Q8NGT1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: TCGAHLTVVILYYGAALSMYLKPSSSNAQKIDKIISLLYGVLTPMLNPII