OR2H2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2098324
Artikelname: OR2H2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2098324
Hersteller Artikelnummer: orb2098324
Alternativnummer: BYT-ORB2098324-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human OR2H2
Konjugation: Biotin
Alternative Synonym: FAT11, OLFR2, OR2H3, OLFR42B, hs6M1-12, dJ271M21.2
OR2H2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 009091
UniProt: O95918
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: FCPDRQVDDFVCEVPALIRLSCEDTSYNEIQVAVASVFILVVPLSLILVS