OR2H1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2098330
| Artikelname: |
OR2H1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2098330 |
| Hersteller Artikelnummer: |
orb2098330 |
| Alternativnummer: |
BYT-ORB2098330-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human OR2H1 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
OR2H6, OR2H8, OR6-2, 6M1-16, HS6M1-16, dJ994E9.4, OLFR42A-9004-14, OLFR42A-9004.14/9026.2 |
| OR2H1 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
35kDa |
| NCBI: |
112145 |
| UniProt: |
Q9GZK4 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: IAVYLQPKNPYAQGRGKFFGLFYAVGTPSLNPLVYTLRNKEIKRALRRLL |
