RAB4A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2098435
Artikelname: RAB4A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2098435
Hersteller Artikelnummer: orb2098435
Alternativnummer: BYT-ORB2098435-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human RAB4A
Konjugation: Biotin
Alternative Synonym: RAB4, HRES1, HRES-1, HRES-1/RAB4
RAB4A Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 24kDa
NCBI: 004569
UniProt: Q53GC2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECG