GRM2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2098501
Artikelname: GRM2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2098501
Hersteller Artikelnummer: orb2098501
Alternativnummer: BYT-ORB2098501-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human GRM2
Konjugation: Biotin
Alternative Synonym: GLUR2, mGlu2, GPRC1B, MGLUR2
GRM2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 95 kDa
NCBI: 006713184
UniProt: Q14416
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: AWLVVEAPGTGKETAPERREVVTLRCNHRDASMLGSLAYNVLLIALCTLY