STX4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2098594
Artikelname: STX4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2098594
Hersteller Artikelnummer: orb2098594
Alternativnummer: BYT-ORB2098594-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human STX4
Konjugation: Biotin
Alternative Synonym: STX4A, p35-2
STX4 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 004595
UniProt: Q12846
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VEMQGEMINRIEKNILSSADYVERGQEHVKTALENQKKARKKKVLIAICV