GOSR1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2098612
Artikelname: GOSR1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2098612
Hersteller Artikelnummer: orb2098612
Alternativnummer: BYT-ORB2098612-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GOSR1
Konjugation: Biotin
Alternative Synonym: P28, GS28, GOS28, GOLIM2, GOS-28, GOS28/P28
GOSR1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 28kDa
NCBI: 004862
UniProt: O95249
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: IHSKMNTLANRFPAVNSLIQRINLRKRRDSLILGGVIGICTILLLLYAFH