SERPINA4 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2099004
Artikelname: SERPINA4 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2099004
Hersteller Artikelnummer: orb2099004
Alternativnummer: BYT-ORB2099004-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SERPINA4
Konjugation: FITC
Alternative Synonym: KAL, KST, PI4, KLST, PI-4, kallistatin
SERPINA4 Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 48kDa
NCBI: 006206
UniProt: P29622
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KGDATVFFILPNQGKMREIEEVLTPEMLMRWNNLLRKRNFYKKLELHLPK