SERPINA1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2099008
Artikelname: SERPINA1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2099008
Hersteller Artikelnummer: orb2099008
Alternativnummer: BYT-ORB2099008-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SERPINA1
Konjugation: Biotin
Alternative Synonym: PI, A1A, AAT, PI1, A1AT, nNIF, PRO2275, alpha1AT
SERPINA1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 44kDa
NCBI: 001121178
UniProt: P01009
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGA