SERPINA9 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2099018
Artikelname: SERPINA9 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2099018
Hersteller Artikelnummer: orb2099018
Alternativnummer: BYT-ORB2099018-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human SERPINA9
Konjugation: HRP
Alternative Synonym: GCET1, SERPINA11, SERPINA11b
SERPINA9 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 37kDa
UniProt: Q86WD7
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: AATTTKFIVRSKDGPSYFTVSFNRTFLMMITNKATDGILFLGKVENPTKS