SERPINA9 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2099019
Artikelname: SERPINA9 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2099019
Hersteller Artikelnummer: orb2099019
Alternativnummer: BYT-ORB2099019-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human SERPINA9
Konjugation: FITC
Alternative Synonym: GCET1, SERPINA11, SERPINA11b
SERPINA9 Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 37kDa
UniProt: Q86WD7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: AATTTKFIVRSKDGPSYFTVSFNRTFLMMITNKATDGILFLGKVENPTKS