SERPINA9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2099020
Artikelname: SERPINA9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2099020
Hersteller Artikelnummer: orb2099020
Alternativnummer: BYT-ORB2099020-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human SERPINA9
Konjugation: Biotin
Alternative Synonym: GCET1, SERPINA11, SERPINA11b
SERPINA9 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 37kDa
UniProt: Q86WD7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: AATTTKFIVRSKDGPSYFTVSFNRTFLMMITNKATDGILFLGKVENPTKS