LCN1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2099051
Artikelname: LCN1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2099051
Hersteller Artikelnummer: orb2099051
Alternativnummer: BYT-ORB2099051-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LCN1
Konjugation: HRP
Alternative Synonym: TP, TLC, PMFA, VEGP
LCN1 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 17kDa
NCBI: 002288
UniProt: P31025
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: PVRGVKLVGRDPKNNLEALEDFEKAAGARGLSTESILIPRQSETCSPGSD