AMBP Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2099115
Artikelname: AMBP Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2099115
Hersteller Artikelnummer: orb2099115
Alternativnummer: BYT-ORB2099115-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AMBP
Konjugation: FITC
Alternative Synonym: A1M, HCP, ITI, UTI, EDC1, HI30, ITIL, IATIL, ITILC
AMBP Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 39kDa
NCBI: 001624
UniProt: P02760
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFS