RORC Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2099129
Artikelname: RORC Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2099129
Hersteller Artikelnummer: orb2099129
Alternativnummer: BYT-ORB2099129-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RORC
Konjugation: HRP
Alternative Synonym: TOR, RORG, RZRG, IMD42, NR1F3, RZR-GAMMA
RORC Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 56kDa
NCBI: 001001523
UniProt: P51449
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: KICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAYSCTRQQNCPIDRTSRN