RORC Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2099130
Artikelname: RORC Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2099130
Hersteller Artikelnummer: orb2099130
Alternativnummer: BYT-ORB2099130-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RORC
Konjugation: FITC
Alternative Synonym: TOR, RORG, RZRG, IMD42, NR1F3, RZR-GAMMA
RORC Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 56kDa
NCBI: 001001523
UniProt: P51449
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAYSCTRQQNCPIDRTSRN