IZUMO1R Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2099169
Artikelname: IZUMO1R Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2099169
Hersteller Artikelnummer: orb2099169
Alternativnummer: BYT-ORB2099169-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FOLR4
Konjugation: FITC
Alternative Synonym: JUNO, FOLR4, Folbp3, FR-delta
IZUMO1R Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 28kDa
NCBI: 001073955
UniProt: C9JJV3
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: TCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYFPTPADLCEKTWSNSFKAS