SELE Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2099184
Artikelname: SELE Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2099184
Hersteller Artikelnummer: orb2099184
Alternativnummer: BYT-ORB2099184-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SELE
Konjugation: FITC
Alternative Synonym: ELAM, ESEL, CD62E, ELAM1, LECAM2
SELE Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 64kDa
NCBI: 000441
UniProt: P16581
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: WVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERC