Ptprc Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2099187
Artikelname: Ptprc Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2099187
Hersteller Artikelnummer: orb2099187
Alternativnummer: BYT-ORB2099187-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Ptprc
Konjugation: FITC
Alternative Synonym: Lca, RT7, CD45, L-CA, T200
Ptprc Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 140kDa
NCBI: 612516
UniProt: P04157
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: FLVFLIIVTSIALLVVLYKIYDLRKKRSSNLDEQQELVERDEEKQLINVD