TFDP3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2100415
Artikelname: TFDP3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2100415
Hersteller Artikelnummer: orb2100415
Alternativnummer: BYT-ORB2100415-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TFDP3
Konjugation: Biotin
Alternative Synonym: DP4, CT30, HCA661
TFDP3 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 38kDa
NCBI: 057605
UniProt: Q5H9I0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: ASDLTNIAIGMLATSSGGSQYSGSRVETPAVEEEEEEDNNDDDLSENDED