NECAB1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2101333
Artikelname: NECAB1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2101333
Hersteller Artikelnummer: orb2101333
Alternativnummer: BYT-ORB2101333-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human NECA1
Konjugation: Biotin
Alternative Synonym: EFCBP1, STIP-1
NECAB1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 38kDa
NCBI: 071746
UniProt: Q8N987
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: DSQETSPSSNNSSEELSSALHLSKGMSIFLDILRRADKNDDGKLSFEEFK