Fn3k Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2101348
Artikelname: Fn3k Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2101348
Hersteller Artikelnummer: orb2101348
Alternativnummer: BYT-ORB2101348-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Fn3k
Konjugation: Biotin
Alternative Synonym: Fnsk
Fn3k Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 22kDa
NCBI: 001102521
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LQAQLDLIEKDYADRETQELWSRLQVKIPELFSGIEIVPALLHGDLWSGN