ANKRD5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2101402
Artikelname: ANKRD5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2101402
Hersteller Artikelnummer: orb2101402
Alternativnummer: BYT-ORB2101402-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ANKRD5
Konjugation: Biotin
Alternative Synonym: ANKRD5
ANKRD5 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 87kDa
NCBI: 071379
UniProt: Q9NU02
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MTIVDNEGKGVLFYCILPTKRHYRCALIALEHGADVNNSTYEGKPIFLRA