CCDC181 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2101507
Artikelname: CCDC181 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2101507
Hersteller Artikelnummer: orb2101507
Alternativnummer: BYT-ORB2101507-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CC181
Konjugation: Biotin
Alternative Synonym: C1orf114
CCDC181 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 55kDa
NCBI: 005245440
UniProt: Q5TID7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SPRRNDIISVPGIQPLDPISDSDSENSFQESKLESQKDLEEEEDEEVRRY