PDP2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2101620
Artikelname: PDP2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2101620
Hersteller Artikelnummer: orb2101620
Alternativnummer: BYT-ORB2101620-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PDP2
Konjugation: FITC
Alternative Synonym: PPM2B, PDPC 2, PPM2C2
PDP2 Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 60kDa
NCBI: 065837
UniProt: Q9P2J9
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: CRAILGVQEDNGMWSCLPLTRDHNAWNQAELSRLKREHPESEDRTIIMED