COG6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2101636
Artikelname: COG6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2101636
Hersteller Artikelnummer: orb2101636
Alternativnummer: BYT-ORB2101636-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human COG6
Konjugation: Biotin
Alternative Synonym: COD2, SHNS, CDG2L
COG6 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 67kDa
NCBI: 065802
UniProt: Q9Y2V7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: ADMATFMVNSLYMMKTTLALFEFTDRRLEMLQFQIEAHLDTLINEQASYV