RAB22A Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2101644
Artikelname: RAB22A Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2101644
Hersteller Artikelnummer: orb2101644
Alternativnummer: BYT-ORB2101644-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAB22A
Konjugation: FITC
Alternative Synonym: MGC16770
RAB22A Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 22kDa
NCBI: 065724
UniProt: P35285
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: IFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRS